PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100250170131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 447aa    MW: 50491.9 Da    PI: 4.8178
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100250170131genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like83.12.9e-26169223155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   kpr+ Wt e+H +F++a+e+LGG  +A+Pk+i+e+m+v++Lt+e+v+SHLQkYR 
  Ote100250170131|100250170131 169 KPRVTWTAEMHGKFLDAIERLGGYLNAVPKRIVEVMGVPDLTRENVASHLQKYRE 223
                                   79****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.9E-514117IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23008.4E-71690No hitNo description
Gene3DG3DSA:1.10.10.603.4E-25166226IPR009057Homeodomain-like
SuperFamilySSF466892.51E-16167227IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-23169223IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MYAEIGANIE AIISIGILLV NDDQTCQNNV TEVLQYCKHQ VLHTGTVYDA LHAIWENRDR  60
LDLVITNAHK LSSEGLAIIE NIKQKLEMNV LLIENDERIE PKGRPLSFSA YVLNDLSVKG  120
FDILLGDARR AENAAVAPNK ASSLTNDAET TERNDNDNDN RNNHRASKKP RVTWTAEMHG  180
KFLDAIERLG GYLNAVPKRI VEVMGVPDLT RENVASHLQK YRESMKSTRN ELGALDFSTL  240
ATFQANLASF PHRIPTLRES NLHYTTASPD LSFGSISTGF SHISDHRNGL DKLRNTTRSR  300
ERSSLCSKFV GYRFEGNSIY YGPVKNINND CILQHSSFRC HQPVSTIQEQ GLLSTCSPKI  360
EEDVRINQHP HHQDLSFSSQ EENGNDFVND ILEQHFSPPS PLPQLSEDLE DIFNQSRNDD  420
EAMINGTENE CEFDFPELDD SFFDQDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-16166226261ARR10-B
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA36591620